HORDB

ID: hor004751
Uniprot ID: Q2V3I3
Protein name: EPIDERMAL PATTERNING FACTOR-like protein 4
Gene name: EPFL4
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
Source: Plant
Expression: Expressed at the base of the apical meristem at 3 days after germination. Not detected in the hypocotyl. Expressed in developing stems soon after bolting, in inflorescence stems and in young siliques.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003674 molecular_function
GO BP: GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development
GO CC: GO:0005576 extracellular region

Sequence: SSIVSADGRWIGQRTGSDLPGGFIRSNKRFGGPGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP
Length: 83(27-109)
Propeptide: MGTFRRRRRFLLAALVTFALLHLFSASSIVSADGRWIGQRTGSDLPGGFIRSNKRFGGPGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP
Signal peptide: MGTFRRRRRFLLAALVTFALLHLFSA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture. Redundantly involved with EPFL6 in procambial development regulation. Controls stomatal patterning. Mediates stomatal
Mechanism: NA
Cross BBB: NA
Target: TMM
Target Unid: Q9SSD1
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004751_AF2.pdb

hor004751_ESM.pdb

Mass:	1047322	Formula:	C395H620N116O110S8
Absent amino acids:		Common amino acids:	GP
pI:	9.84	Basic residues:	13
Polar residues:	32	Hydrophobic residues:	18
Hydrophobicity:	-52.41	Boman Index:	-13304
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	50.48
Instability Index:	7062.65	Extinction Coefficient cystines:	14355
Absorbance 280nm:	175.06

PubMed ID: 19435754
Title: Epidermal cell density is autoregulated via a secretory peptide, EPIDERMAL PATTERNING FACTOR 2 in Arabidopsis leaves.
PubMed ID: 22027592
Title: The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones.
PubMed ID: 21862708
Title: Regulation of inflorescence
PubMed ID: 22474391
Title:
PubMed ID: 23881395
Title: