General Information

  • ID:  hor004751
  • Uniprot ID:  Q2V3I3(27-109)
  • Protein name:  EPIDERMAL PATTERNING FACTOR-like protein 4
  • Gene name:  EPFL4
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
  • Source:  Plant
  • Expression:  Expressed at the base of the apical meristem at 3 days after germination. Not detected in the hypocotyl. Expressed in developing stems soon after bolting, in inflorescence stems and in young siliques.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SSIVSADGRWIGQRTGSDLPGGFIRSNKRFGGPGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP
  • Length:  83(27-109)
  • Propeptide:  MGTFRRRRRFLLAALVTFALLHLFSASSIVSADGRWIGQRTGSDLPGGFIRSNKRFGGPGSSPPTCRSKCGKCQPCKPVHVPIQPGLSMPLEYYPEAWRCKCGNKLFMP
  • Signal peptide:  MGTFRRRRRFLLAALVTFALLHLFSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture. Redundantly involved with EPFL6 in procambial development regulation. Controls stomatal patterning. Mediates stomatal
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  TMM
  • Target Unid:  Q9SSD1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  40-74; 44-50; 47-76
  • Structure ID:  AF-Q2V3I3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004751_AF2.pdbhor004751_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 1047322 Formula: C395H620N116O110S8
Absent amino acids: Common amino acids: GP
pI: 9.84 Basic residues: 13
Polar residues: 32 Hydrophobic residues: 18
Hydrophobicity: -52.41 Boman Index: -13304
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 50.48
Instability Index: 7062.65 Extinction Coefficient cystines: 14355
Absorbance 280nm: 175.06

Literature

  • PubMed ID:  19435754
  • Title:  Epidermal cell density is autoregulated via a secretory peptide, EPIDERMAL PATTERNING FACTOR 2 in Arabidopsis leaves.
  • PubMed ID:  22027592
  • Title:   The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones.
  • PubMed ID:  21862708
  • Title:  Regulation of inflorescence
  • PubMed ID:  22474391
  • Title:  
  • PubMed ID:  23881395
  • Title: